Few peptides have generated as much sustained scientific interest as Thymosin Beta-4 and its synthetic counterpart, TB-500. From early immunological studies in the 1960s to modern investigations into tissue repair and cellular migration, Thymosin Beta-4 has carved out a fascinating niche in biomedical research. For laboratories and researchers exploring the mechanisms of wound healing, cardiac repair, and cellular motility, TB-500 has become an indispensable research tool.
In this article, we take a thorough look at what the published literature tells us about this peptide — where the science stands, what the key findings have been, and why TB-500 continues to attract attention from research groups around the world.
What Is TB-500?
TB-500 is a synthetic peptide that corresponds to a specific active region of Thymosin Beta-4 (T$\beta$4), a naturally occurring 43-amino acid protein found in virtually all mammalian cells. More precisely, TB-500 replicates the actin-binding domain of the full-length Thymosin Beta-4 molecule, which is the segment that researchers have identified as central to many of the protein’s observed biological activities.
Thymosin Beta-4 itself was first isolated from the thymus gland — hence the name “thymosin” — during pioneering work by Allan Goldstein and colleagues at the Albert Einstein College of Medicine in the 1960s and 1970s. The Goldstein laboratory’s research was initially focused on the role of the thymus in immune function, and it was during this broader program of work that the thymosin family of peptides was characterised. Over time, it became clear that Thymosin Beta-4 was not just an immune modulator; its presence in nearly every cell type hinted at something far more fundamental.
The protein’s amino acid sequence — SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES — places it among the beta-thymosin family, a group of small, highly conserved proteins. Its widespread distribution throughout the body, from platelets and white blood cells to the cells of the skin and cornea, pointed researchers toward its involvement in basic cellular processes that go well beyond immune regulation.
The Role of Thymosin Beta-4 in Cellular Biology
Actin Regulation
The most well-characterised function of Thymosin Beta-4 is its role as a major actin-sequestering protein. Actin is one of the most abundant proteins in eukaryotic cells, forming the structural filaments that give cells their shape, enable movement, and facilitate division. Actin exists in two states: monomeric (G-actin) and filamentous (F-actin). The balance between these two forms is critical for essentially every process that involves cellular structure or motility.
Thymosin Beta-4 binds to G-actin monomers and maintains a reservoir of unpolymerised actin within the cell. This reservoir can be rapidly deployed when the cell needs to reorganise its cytoskeleton — during migration, for instance, or during wound closure. By regulating the availability of actin monomers, Thymosin Beta-4 acts as a kind of cellular logistics manager, ensuring that the raw materials for cytoskeletal remodelling are available on demand.
This is not a peripheral function. In platelets, Thymosin Beta-4 is one of the most abundant proteins present, precisely because platelets rely on rapid actin reorganisation during clot formation. This gives some indication of how central this peptide is to the cellular machinery of repair and response.
Cell Migration and Motility
Closely related to its actin-binding activity is the role Thymosin Beta-4 plays in cell migration. Studies have demonstrated that Thymosin Beta-4 promotes the migration of endothelial cells, keratinocytes, and other cell types in vitro. This is significant because cell migration is a rate-limiting step in many biological repair processes. Whether the context is closing a wound, forming new blood vessels, or regenerating damaged tissue, cells need to physically move to the site where they are needed.
Research has shown that Thymosin Beta-4 promotes this migration through multiple mechanisms, including its effects on actin dynamics and its interactions with signalling pathways involved in cellular motility. The peptide appears to create conditions that make it easier for cells to move — loosening cell-cell adhesions, promoting the formation of lamellipodia (the leading edge structures that cells use to crawl), and modulating the extracellular matrix.
Key Research Areas
Wound Healing Models
One of the most extensively studied applications of Thymosin Beta-4 and TB-500 in research settings involves wound healing. In animal models, topical and systemic administration of Thymosin Beta-4 has been associated with accelerated wound closure, increased angiogenesis at the wound site, and reduced inflammation.
A landmark series of studies demonstrated that Thymosin Beta-4 promoted dermal wound healing in rat models, with treated subjects showing faster closure rates and improved collagen deposition compared to controls. The peptide appeared to act at multiple stages of the wound healing cascade — promoting the initial inflammatory response, enhancing the proliferative phase through increased cell migration and angiogenesis, and influencing the remodelling phase.
These findings have been replicated across multiple laboratories and animal models, establishing wound healing as one of the most robust areas of Thymosin Beta-4 research.
Cardiac Repair Studies
Perhaps the most striking research findings involving Thymosin Beta-4 have come from cardiac repair studies. The work of Ildiko Bock-Marquette and colleagues, published in Nature in 2004, demonstrated that Thymosin Beta-4 promoted survival of cardiomyocytes (heart muscle cells) following experimental myocardial infarction in mouse models. This was a significant finding because the adult mammalian heart has very limited regenerative capacity, and myocardial infarction typically results in permanent loss of functional cardiac tissue.
The Bock-Marquette study showed that Thymosin Beta-4 activated Akt, a protein kinase with well-established roles in cell survival signalling. In their mouse model, treatment with Thymosin Beta-4 after induced cardiac injury was associated with reduced scar formation and improved cardiac function compared to untreated controls.
Subsequent research has built on these findings, exploring the mechanisms by which Thymosin Beta-4 might promote cardiac repair. Studies have investigated its effects on cardiac progenitor cells, its role in reducing fibrosis, and its potential involvement in activating epicardial cells — a population of cells on the outer surface of the heart that may retain some regenerative potential. This body of work has positioned Thymosin Beta-4 as one of the more promising peptides in cardiovascular research.
Angiogenesis
Angiogenesis — the formation of new blood vessels from pre-existing vasculature — is another area where Thymosin Beta-4 research has produced compelling results. In vitro studies have shown that Thymosin Beta-4 promotes endothelial cell differentiation and tube formation, which are standard laboratory measures of angiogenic potential.
In vivo work in animal models has corroborated these findings. The pro-angiogenic properties of Thymosin Beta-4 are thought to be one of the key mechanisms underlying its effects in wound healing and cardiac repair, since both processes depend heavily on the establishment of new blood supply to deliver oxygen and nutrients to regenerating tissues.
Corneal Healing Research
The work of Gabriel Sosne and colleagues represents another important thread in Thymosin Beta-4 research. Sosne’s laboratory has published extensively on the effects of Thymosin Beta-4 in corneal wound healing models. Their research has demonstrated that Thymosin Beta-4 promotes corneal epithelial cell migration, reduces inflammation in the cornea, and accelerates wound closure in animal models of corneal injury.
This line of investigation is particularly noteworthy because it has advanced further toward translational development than many other areas of Thymosin Beta-4 research. The cornea presents a relatively accessible tissue for topical peptide application, and the results from preclinical corneal studies have been among the most consistent in the Thymosin Beta-4 literature.
Sosne’s work has also contributed to understanding the anti-inflammatory mechanisms of Thymosin Beta-4, demonstrating reductions in pro-inflammatory cytokines and chemokines in treated corneal tissues.
Hair Follicle Research
An interesting offshoot of Thymosin Beta-4 research has involved hair follicle biology. Studies in animal models have noted that Thymosin Beta-4 treatment was associated with increased hair growth, an observation that appears to be linked to the peptide’s effects on stem cell migration and differentiation within the hair follicle niche.
Research has suggested that Thymosin Beta-4 may promote the activation of hair follicle stem cells and their migration from the bulge region of the follicle, potentially stimulating the transition from the resting phase (telogen) to the active growth phase (anagen) of the hair cycle. While this remains a less thoroughly investigated area compared to wound healing or cardiac repair, it has generated considerable interest as a research direction.
Anti-Inflammatory Properties
Across multiple research contexts, Thymosin Beta-4 has demonstrated anti-inflammatory effects. In wound healing models, corneal injury studies, and cardiac research, treatment with Thymosin Beta-4 has been associated with reduced levels of pro-inflammatory mediators and decreased inflammatory cell infiltration.
The anti-inflammatory mechanisms appear to involve modulation of NF-kB signalling pathways and reductions in the expression of inflammatory cytokines such as IL-1, IL-8, and TNF-alpha. These properties are thought to work in concert with the peptide’s pro-migratory and pro-angiogenic effects to create an environment conducive to tissue repair rather than chronic inflammation.
How TB-500 Differs from Full-Length Thymosin Beta-4
This is an important distinction for researchers to understand. TB-500 is not the full 43-amino acid Thymosin Beta-4 protein. Rather, it is a synthetic peptide that encompasses the active region of Thymosin Beta-4 — specifically, the segment containing the actin-binding motif and surrounding residues that have been identified as critical for biological activity.
The rationale for using this shorter synthetic fragment in research is twofold. First, the active region of Thymosin Beta-4 has been shown to recapitulate many of the key biological activities of the full-length protein, including its effects on cell migration, actin regulation, and wound healing in laboratory models. Second, synthetic peptides corresponding to specific active domains can be produced more efficiently and with greater consistency than the full-length protein, making them practical tools for laboratory research.
That said, it is worth noting that the full-length Thymosin Beta-4 protein may possess activities or interactions that are not fully captured by the shorter TB-500 fragment. Research comparing the two forms directly is limited, and investigators should be aware that results obtained with TB-500 may not be entirely equivalent to those obtained with full-length Thymosin Beta-4. The broader structural context of the full-length protein, including potential post-translational modifications and protein-protein interactions involving regions outside the core active domain, could influence biological outcomes.
Current State of Research and Future Directions
Thymosin Beta-4 and TB-500 remain active areas of investigation across multiple disciplines. Cardiac repair research continues to explore the peptide’s mechanisms of action and its effects on various cell populations within the heart. Corneal healing research has progressed through multiple preclinical stages. And newer lines of inquiry — including investigations into neurological repair models, musculoskeletal tissue healing, and the peptide’s potential role in modulating fibrosis — continue to expand the scope of Thymosin Beta-4 research.
One of the more intriguing emerging directions involves the intersection of Thymosin Beta-4 research with stem cell biology. Several studies have suggested that Thymosin Beta-4 may influence the behaviour of resident tissue stem cells, potentially promoting their activation, migration, and differentiation. If confirmed and elaborated, this could help explain the peptide’s apparent effects across such a wide range of tissue types and injury models.
Another area of growing interest is the development of modified or optimised versions of Thymosin Beta-4-derived peptides, including fragments, analogues, and fusion proteins designed to enhance stability, tissue targeting, or biological potency. These efforts reflect the broader trend in peptide research toward rational design and engineering.
As with any active area of biomedical research, the Thymosin Beta-4 field continues to evolve. New findings regularly refine our understanding of the peptide’s mechanisms and potential applications. Researchers working with TB-500 benefit from engaging with the primary literature on an ongoing basis, as the body of evidence grows and earlier findings are contextualised by more recent work.
Handling and Storage Notes for Researchers
Proper handling and storage of TB-500 are essential for maintaining peptide integrity and ensuring reproducible results in research applications.
Storage temperature: Lyophilised (freeze-dried) TB-500 should be stored at -20 degrees C or below for long-term storage. Short-term storage at 2-8 degrees C (standard refrigerator temperature) is acceptable for peptide that will be used within a few weeks.
Reconstitution: When reconstituting lyophilised TB-500, bacteriostatic water or sterile saline are commonly used solvents in research settings. Gentle swirling rather than vigorous shaking is recommended to avoid damaging the peptide through mechanical stress or foaming.
Reconstituted peptide storage: Once reconstituted, TB-500 solutions should be stored at 2-8 degrees C and used within a reasonable timeframe, typically within a few weeks. For longer storage of reconstituted peptide, aliquoting and freezing at -20 degrees C is advisable to avoid repeated freeze-thaw cycles.
Avoid repeated freeze-thaw cycles: Each freeze-thaw cycle can degrade peptide integrity. Aliquoting reconstituted peptide into single-use portions before freezing is best practice.
Protect from light: As with many peptides, TB-500 should be protected from prolonged exposure to direct light, which can contribute to degradation.
Handle with appropriate laboratory PPE: Standard laboratory personal protective equipment should be used when handling research peptides.
Conclusion
TB-500 occupies a genuinely interesting position in the peptide research landscape. Its parent molecule, Thymosin Beta-4, plays a fundamental role in cellular biology through its regulation of actin dynamics and its influence on cell migration, angiogenesis, and inflammatory responses. The published literature — spanning decades of work from the Goldstein laboratory’s foundational thymosin research through to the cardiac repair studies of Bock-Marquette and the corneal healing investigations of Sosne — provides a substantial evidence base for researchers to build upon.
For research laboratories investigating tissue repair, cellular motility, or related biological processes, TB-500 offers a well-characterised and accessible tool. As the field continues to advance, we can expect the body of knowledge surrounding this peptide to deepen, opening new avenues for investigation and furthering our understanding of the fundamental biology of repair and regeneration.
This article is provided for informational and educational purposes only. TB-500 is sold strictly for laboratory research use. It is not intended for human consumption, therapeutic use, or diagnostic purposes. Always consult the relevant published literature and adhere to institutional guidelines when conducting research with peptides.
Trusted Peptides — Research-grade peptides for the scientific community.
TB-500 and Thymosin Beta-4: What the Research Tells Us
Few peptides have generated as much sustained scientific interest as Thymosin Beta-4 and its synthetic counterpart, TB-500. From early immunological studies in the 1960s to modern investigations into tissue repair and cellular migration, Thymosin Beta-4 has carved out a fascinating niche in biomedical research. For laboratories and researchers exploring the mechanisms of wound healing, cardiac repair, and cellular motility, TB-500 has become an indispensable research tool.
In this article, we take a thorough look at what the published literature tells us about this peptide — where the science stands, what the key findings have been, and why TB-500 continues to attract attention from research groups around the world.
What Is TB-500?
TB-500 is a synthetic peptide that corresponds to a specific active region of Thymosin Beta-4 (T$\beta$4), a naturally occurring 43-amino acid protein found in virtually all mammalian cells. More precisely, TB-500 replicates the actin-binding domain of the full-length Thymosin Beta-4 molecule, which is the segment that researchers have identified as central to many of the protein’s observed biological activities.
Thymosin Beta-4 itself was first isolated from the thymus gland — hence the name “thymosin” — during pioneering work by Allan Goldstein and colleagues at the Albert Einstein College of Medicine in the 1960s and 1970s. The Goldstein laboratory’s research was initially focused on the role of the thymus in immune function, and it was during this broader program of work that the thymosin family of peptides was characterised. Over time, it became clear that Thymosin Beta-4 was not just an immune modulator; its presence in nearly every cell type hinted at something far more fundamental.
The protein’s amino acid sequence — SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES — places it among the beta-thymosin family, a group of small, highly conserved proteins. Its widespread distribution throughout the body, from platelets and white blood cells to the cells of the skin and cornea, pointed researchers toward its involvement in basic cellular processes that go well beyond immune regulation.
The Role of Thymosin Beta-4 in Cellular Biology
Actin Regulation
The most well-characterised function of Thymosin Beta-4 is its role as a major actin-sequestering protein. Actin is one of the most abundant proteins in eukaryotic cells, forming the structural filaments that give cells their shape, enable movement, and facilitate division. Actin exists in two states: monomeric (G-actin) and filamentous (F-actin). The balance between these two forms is critical for essentially every process that involves cellular structure or motility.
Thymosin Beta-4 binds to G-actin monomers and maintains a reservoir of unpolymerised actin within the cell. This reservoir can be rapidly deployed when the cell needs to reorganise its cytoskeleton — during migration, for instance, or during wound closure. By regulating the availability of actin monomers, Thymosin Beta-4 acts as a kind of cellular logistics manager, ensuring that the raw materials for cytoskeletal remodelling are available on demand.
This is not a peripheral function. In platelets, Thymosin Beta-4 is one of the most abundant proteins present, precisely because platelets rely on rapid actin reorganisation during clot formation. This gives some indication of how central this peptide is to the cellular machinery of repair and response.
Cell Migration and Motility
Closely related to its actin-binding activity is the role Thymosin Beta-4 plays in cell migration. Studies have demonstrated that Thymosin Beta-4 promotes the migration of endothelial cells, keratinocytes, and other cell types in vitro. This is significant because cell migration is a rate-limiting step in many biological repair processes. Whether the context is closing a wound, forming new blood vessels, or regenerating damaged tissue, cells need to physically move to the site where they are needed.
Research has shown that Thymosin Beta-4 promotes this migration through multiple mechanisms, including its effects on actin dynamics and its interactions with signalling pathways involved in cellular motility. The peptide appears to create conditions that make it easier for cells to move — loosening cell-cell adhesions, promoting the formation of lamellipodia (the leading edge structures that cells use to crawl), and modulating the extracellular matrix.
Key Research Areas
Wound Healing Models
One of the most extensively studied applications of Thymosin Beta-4 and TB-500 in research settings involves wound healing. In animal models, topical and systemic administration of Thymosin Beta-4 has been associated with accelerated wound closure, increased angiogenesis at the wound site, and reduced inflammation.
A landmark series of studies demonstrated that Thymosin Beta-4 promoted dermal wound healing in rat models, with treated subjects showing faster closure rates and improved collagen deposition compared to controls. The peptide appeared to act at multiple stages of the wound healing cascade — promoting the initial inflammatory response, enhancing the proliferative phase through increased cell migration and angiogenesis, and influencing the remodelling phase.
These findings have been replicated across multiple laboratories and animal models, establishing wound healing as one of the most robust areas of Thymosin Beta-4 research.
Cardiac Repair Studies
Perhaps the most striking research findings involving Thymosin Beta-4 have come from cardiac repair studies. The work of Ildiko Bock-Marquette and colleagues, published in Nature in 2004, demonstrated that Thymosin Beta-4 promoted survival of cardiomyocytes (heart muscle cells) following experimental myocardial infarction in mouse models. This was a significant finding because the adult mammalian heart has very limited regenerative capacity, and myocardial infarction typically results in permanent loss of functional cardiac tissue.
The Bock-Marquette study showed that Thymosin Beta-4 activated Akt, a protein kinase with well-established roles in cell survival signalling. In their mouse model, treatment with Thymosin Beta-4 after induced cardiac injury was associated with reduced scar formation and improved cardiac function compared to untreated controls.
Subsequent research has built on these findings, exploring the mechanisms by which Thymosin Beta-4 might promote cardiac repair. Studies have investigated its effects on cardiac progenitor cells, its role in reducing fibrosis, and its potential involvement in activating epicardial cells — a population of cells on the outer surface of the heart that may retain some regenerative potential. This body of work has positioned Thymosin Beta-4 as one of the more promising peptides in cardiovascular research.
Angiogenesis
Angiogenesis — the formation of new blood vessels from pre-existing vasculature — is another area where Thymosin Beta-4 research has produced compelling results. In vitro studies have shown that Thymosin Beta-4 promotes endothelial cell differentiation and tube formation, which are standard laboratory measures of angiogenic potential.
In vivo work in animal models has corroborated these findings. The pro-angiogenic properties of Thymosin Beta-4 are thought to be one of the key mechanisms underlying its effects in wound healing and cardiac repair, since both processes depend heavily on the establishment of new blood supply to deliver oxygen and nutrients to regenerating tissues.
Corneal Healing Research
The work of Gabriel Sosne and colleagues represents another important thread in Thymosin Beta-4 research. Sosne’s laboratory has published extensively on the effects of Thymosin Beta-4 in corneal wound healing models. Their research has demonstrated that Thymosin Beta-4 promotes corneal epithelial cell migration, reduces inflammation in the cornea, and accelerates wound closure in animal models of corneal injury.
This line of investigation is particularly noteworthy because it has advanced further toward translational development than many other areas of Thymosin Beta-4 research. The cornea presents a relatively accessible tissue for topical peptide application, and the results from preclinical corneal studies have been among the most consistent in the Thymosin Beta-4 literature.
Sosne’s work has also contributed to understanding the anti-inflammatory mechanisms of Thymosin Beta-4, demonstrating reductions in pro-inflammatory cytokines and chemokines in treated corneal tissues.
Hair Follicle Research
An interesting offshoot of Thymosin Beta-4 research has involved hair follicle biology. Studies in animal models have noted that Thymosin Beta-4 treatment was associated with increased hair growth, an observation that appears to be linked to the peptide’s effects on stem cell migration and differentiation within the hair follicle niche.
Research has suggested that Thymosin Beta-4 may promote the activation of hair follicle stem cells and their migration from the bulge region of the follicle, potentially stimulating the transition from the resting phase (telogen) to the active growth phase (anagen) of the hair cycle. While this remains a less thoroughly investigated area compared to wound healing or cardiac repair, it has generated considerable interest as a research direction.
Anti-Inflammatory Properties
Across multiple research contexts, Thymosin Beta-4 has demonstrated anti-inflammatory effects. In wound healing models, corneal injury studies, and cardiac research, treatment with Thymosin Beta-4 has been associated with reduced levels of pro-inflammatory mediators and decreased inflammatory cell infiltration.
The anti-inflammatory mechanisms appear to involve modulation of NF-kB signalling pathways and reductions in the expression of inflammatory cytokines such as IL-1, IL-8, and TNF-alpha. These properties are thought to work in concert with the peptide’s pro-migratory and pro-angiogenic effects to create an environment conducive to tissue repair rather than chronic inflammation.
How TB-500 Differs from Full-Length Thymosin Beta-4
This is an important distinction for researchers to understand. TB-500 is not the full 43-amino acid Thymosin Beta-4 protein. Rather, it is a synthetic peptide that encompasses the active region of Thymosin Beta-4 — specifically, the segment containing the actin-binding motif and surrounding residues that have been identified as critical for biological activity.
The rationale for using this shorter synthetic fragment in research is twofold. First, the active region of Thymosin Beta-4 has been shown to recapitulate many of the key biological activities of the full-length protein, including its effects on cell migration, actin regulation, and wound healing in laboratory models. Second, synthetic peptides corresponding to specific active domains can be produced more efficiently and with greater consistency than the full-length protein, making them practical tools for laboratory research.
That said, it is worth noting that the full-length Thymosin Beta-4 protein may possess activities or interactions that are not fully captured by the shorter TB-500 fragment. Research comparing the two forms directly is limited, and investigators should be aware that results obtained with TB-500 may not be entirely equivalent to those obtained with full-length Thymosin Beta-4. The broader structural context of the full-length protein, including potential post-translational modifications and protein-protein interactions involving regions outside the core active domain, could influence biological outcomes.
Current State of Research and Future Directions
Thymosin Beta-4 and TB-500 remain active areas of investigation across multiple disciplines. Cardiac repair research continues to explore the peptide’s mechanisms of action and its effects on various cell populations within the heart. Corneal healing research has progressed through multiple preclinical stages. And newer lines of inquiry — including investigations into neurological repair models, musculoskeletal tissue healing, and the peptide’s potential role in modulating fibrosis — continue to expand the scope of Thymosin Beta-4 research.
One of the more intriguing emerging directions involves the intersection of Thymosin Beta-4 research with stem cell biology. Several studies have suggested that Thymosin Beta-4 may influence the behaviour of resident tissue stem cells, potentially promoting their activation, migration, and differentiation. If confirmed and elaborated, this could help explain the peptide’s apparent effects across such a wide range of tissue types and injury models.
Another area of growing interest is the development of modified or optimised versions of Thymosin Beta-4-derived peptides, including fragments, analogues, and fusion proteins designed to enhance stability, tissue targeting, or biological potency. These efforts reflect the broader trend in peptide research toward rational design and engineering.
As with any active area of biomedical research, the Thymosin Beta-4 field continues to evolve. New findings regularly refine our understanding of the peptide’s mechanisms and potential applications. Researchers working with TB-500 benefit from engaging with the primary literature on an ongoing basis, as the body of evidence grows and earlier findings are contextualised by more recent work.
Handling and Storage Notes for Researchers
Proper handling and storage of TB-500 are essential for maintaining peptide integrity and ensuring reproducible results in research applications.
Conclusion
TB-500 occupies a genuinely interesting position in the peptide research landscape. Its parent molecule, Thymosin Beta-4, plays a fundamental role in cellular biology through its regulation of actin dynamics and its influence on cell migration, angiogenesis, and inflammatory responses. The published literature — spanning decades of work from the Goldstein laboratory’s foundational thymosin research through to the cardiac repair studies of Bock-Marquette and the corneal healing investigations of Sosne — provides a substantial evidence base for researchers to build upon.
For research laboratories investigating tissue repair, cellular motility, or related biological processes, TB-500 offers a well-characterised and accessible tool. As the field continues to advance, we can expect the body of knowledge surrounding this peptide to deepen, opening new avenues for investigation and furthering our understanding of the fundamental biology of repair and regeneration.
This article is provided for informational and educational purposes only. TB-500 is sold strictly for laboratory research use. It is not intended for human consumption, therapeutic use, or diagnostic purposes. Always consult the relevant published literature and adhere to institutional guidelines when conducting research with peptides.
Trusted Peptides — Research-grade peptides for the scientific community.